PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874298.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family G2-like
Protein Properties Length: 404aa    MW: 45141.5 Da    PI: 6.8671
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874298.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32261316156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  XP_015874298.1 261 KQRRCWSPELHRRFVSALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 316
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-30258319IPR009057Homeodomain-like
SuperFamilySSF466893.59E-18258319IPR009057Homeodomain-like
PROSITE profilePS5129414.214258318IPR017930Myb domain
TIGRFAMsTIGR015571.2E-26261316IPR006447Myb domain, plants
PfamPF002499.6E-8263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGSVLAELSL DFRPTFVPKT IRDFLKEVSM IRNVPERVAK FDDFLKRLEE EMRKIDAFKR  60
ELPLCMLLLN DAILTLKEEL TQCAVPNAEP VLEEFIPLKK DCDENEEQNN DNKEKDCKDK  120
KNWMSSVQLW NTDDYPTTDF KIDPKLTSKT EIKRNEKEYG FTTEDPVHCS RNRTGGRSFI  180
PFKAYSAFPG IRKEDKDELP VHGLSLLTPG VKNPKEESGS SGSRSTSSRA VSSSAAAAAA  240
VNVQSNLRAG QQQPQQQTSR KQRRCWSPEL HRRFVSALQQ LGGSQVATPK QIRELMQVDG  300
LTNDEVKSHL QKYRLHTRRL PASSAAPANQ SIVVLSGLWM SQDQYGDSSK ASSSQSGSPQ  360
GPLQLTGTGG TSTTGCDSME DDEDARSEGY SWKSHVHKPG NDDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874298.10.0PREDICTED: uncharacterized protein LOC107411267
TrEMBLA5BS050.0A5BS05_VITVI; Putative uncharacterized protein
STRINGVIT_03s0063g01060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-51G2-like family protein